Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646915.1	internal	168	2-505(+)
Amino Acid sequence :
VRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSMARGNAAVPAMEMTKWFDTNY HFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLS
Physicochemical properties
Number of amino acids:		168
Molecular weight:		18,660.880
Theoretical pI:		5.786
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		35410 35410
Instability index:		31.276
aromaticity		0.131
GRAVY		-0.215
Secondary Structure Fraction
Helix		0.310
turn		0.250
sheet		0.256