Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646917.1 | 3prime_partial | 228 | 55-738(+) |
Amino Acid sequence : | |||
MPIESSIPTPLGPAACEKDAKALQFIEEMTINADPVQEKVLAEILSRNAKTEYLRRYHLDGATDRHNFKSKVPVITYEDLQPEIQRIANGDRTSILSADPISEFLTSSGTSAGERKLMPT IQEELDRRQVLYSLLMPVMNLYVPGLDKGKGLYFLFIKSETKTPGGLVARPVLTSYYKSDHFKARPYDPYMVYTSPNEAILCTDSYQSMYTQMFCGLYHREEVLRVGA | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 25,787.246 | ||
Theoretical pI: | 5.866 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20860 20985 | ||
Instability index: | 60.221 | ||
aromaticity | 0.092 | ||
GRAVY | -0.349 | ||
Secondary Structure Fraction | |||
Helix | 0.303 | ||
turn | 0.224 | ||
sheet | 0.276 |