Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646920.1 | internal | 201 | 2-604(+) |
Amino Acid sequence : | |||
SGTCHVMALPYPAQSHLNAMMNLCKLMATKSPKMIITVVVTEAYLDLVSPAPELPNIRFRSVPDFWPRGVNLATDFVGYTSAVNREMPGPCEQLLDQLETPATAIIADSQHRWAFNVAER RNIPSVALWPMSPSVFTVMYHFHLLVKNRHFPADLSERGEEIVDYIPGLPPTCLADFPAIFSKDVELQLDESLKCFACLRS | |||
Physicochemical properties | |||
Number of amino acids: | 201 | ||
Molecular weight: | 14,998.987 | ||
Theoretical pI: | 9.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 25.261 | ||
aromaticity | 0.086 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.259 | ||
sheet | 0.209 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646920.1 | 3prime_partial | 139 | 417-1(-) |
Amino Acid sequence : | |||
MTVNTEGDIGHNATDGIFLRSATLKAHRCCESAIIAVAGVSNWSRSCSHGPGISLLTADVYPTKSVARFTPRGQKSGTDRNRMFGSSGAGDTKSRYASVTTTVMIILGDLVAINLQRFIM AFKWLWAGYGKAITWQVPE | |||
Physicochemical properties | |||
Number of amino acids: | 139 | ||
Molecular weight: | 14,998.987 | ||
Theoretical pI: | 9.601 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 25.261 | ||
aromaticity | 0.086 | ||
GRAVY | -0.032 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.259 | ||
sheet | 0.209 |