Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646920.1	internal	201	2-604(+)
Amino Acid sequence :
SGTCHVMALPYPAQSHLNAMMNLCKLMATKSPKMIITVVVTEAYLDLVSPAPELPNIRFRSVPDFWPRGVNLATDFVGYTSAVNREMPGPCEQLLDQLETPATAIIADSQHRWAFNVAER RNIPSVALWPMSPSVFTVMYHFHLLVKNRHFPADLSERGEEIVDYIPGLPPTCLADFPAIFSKDVELQLDESLKCFACLRS
Physicochemical properties
Number of amino acids:		201
Molecular weight:		14,998.987
Theoretical pI:		9.601
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		25.261
aromaticity		0.086
GRAVY		-0.032
Secondary Structure Fraction
Helix		0.281
turn		0.259
sheet		0.209

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646920.1	3prime_partial	139	417-1(-)
Amino Acid sequence :
MTVNTEGDIGHNATDGIFLRSATLKAHRCCESAIIAVAGVSNWSRSCSHGPGISLLTADVYPTKSVARFTPRGQKSGTDRNRMFGSSGAGDTKSRYASVTTTVMIILGDLVAINLQRFIM AFKWLWAGYGKAITWQVPE
Physicochemical properties
Number of amino acids:		139
Molecular weight:		14,998.987
Theoretical pI:		9.601
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		25.261
aromaticity		0.086
GRAVY		-0.032
Secondary Structure Fraction
Helix		0.281
turn		0.259
sheet		0.209