Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646929.1 | internal | 211 | 3-635(+) |
Amino Acid sequence : | |||
ELEPLQESAQTLKAPPGNGQIRHRTPSSVELESQSHLQSSDQDQDYDQGHHHFEKMVKRTRQESFSDKIFRFRGAILVVSVPLLLISFVLYLMPNSRSVGSFVTSQPEDVALKQRAFVNR KAGSKSYAVIFDAGSSGSRVHVFCFDENLNLVSIGKDLELFKQKKPGLSAYASDPKEAAKSLQSLLEEAEFAVPKDLRSKTPVRVGATAGL | |||
Physicochemical properties | |||
Number of amino acids: | 211 | ||
Molecular weight: | 23,346.130 | ||
Theoretical pI: | 8.645 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 56.726 | ||
aromaticity | 0.076 | ||
GRAVY | -0.399 | ||
Secondary Structure Fraction | |||
Helix | 0.289 | ||
turn | 0.256 | ||
sheet | 0.256 |