Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646929.1	internal	211	3-635(+)
Amino Acid sequence :
ELEPLQESAQTLKAPPGNGQIRHRTPSSVELESQSHLQSSDQDQDYDQGHHHFEKMVKRTRQESFSDKIFRFRGAILVVSVPLLLISFVLYLMPNSRSVGSFVTSQPEDVALKQRAFVNR KAGSKSYAVIFDAGSSGSRVHVFCFDENLNLVSIGKDLELFKQKKPGLSAYASDPKEAAKSLQSLLEEAEFAVPKDLRSKTPVRVGATAGL
Physicochemical properties
Number of amino acids:		211
Molecular weight:		23,346.130
Theoretical pI:		8.645
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		5960 5960
Instability index:		56.726
aromaticity		0.076
GRAVY		-0.399
Secondary Structure Fraction
Helix		0.289
turn		0.256
sheet		0.256