Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646942.1 | internal | 147 | 441-1(-) |
Amino Acid sequence : | |||
PGGSGIGIRIGLEVRIHSPVSGKAALLGLKLFLFGVGNTIKFMDFTLQLDHTSTVCSCFDLNLVCSRLVVDAQCSSFNHAVLARIPLFVQLLYSFPHMLERNRFGEMVFLDAPSAPISFN KGTLLHYSGHNLFCKFVHVKHGSLEES | |||
Physicochemical properties | |||
Number of amino acids: | 147 | ||
Molecular weight: | 15,681.662 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 34.165 | ||
aromaticity | 0.091 | ||
GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.182 | ||
sheet | 0.336 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646942.1 | 5prime_partial | 143 | 1-432(+) |
Amino Acid sequence : | |||
RFFKAAVLHMHELAEKIMPAVVKKGALVEGDGCAGSIKEYHFTEAIPFKHVRERVEELDKEGYACKYSVIEGGTLGIYYKSATNKVKIEAGANGGSVIKLEGEIHELDGVAYPEEEKLKT KEGSLATYRAVDAYLQANPDAYA* | |||
Physicochemical properties | |||
Number of amino acids: | 143 | ||
Molecular weight: | 15,681.662 | ||
Theoretical pI: | 5.769 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13410 13535 | ||
Instability index: | 34.165 | ||
aromaticity | 0.091 | ||
GRAVY | -0.319 | ||
Secondary Structure Fraction | |||
Helix | 0.294 | ||
turn | 0.182 | ||
sheet | 0.336 |