Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646944.1 | 3prime_partial | 123 | 366-734(+) |
Amino Acid sequence : | |||
MSKYNKALTIMKSLPSTDPRSFMRQANIHCIYCTGAYNQKHSNSLLKIHRSRMFFPFHRMMIYFHERILGSLMGDDTFALPFWNWDNPEGMFIPDMYLNGSFIDTQRDRIHLPPQVADID FDY | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 14,617.690 | ||
Theoretical pI: | 7.845 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19940 20065 | ||
Instability index: | 43.365 | ||
aromaticity | 0.146 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.236 | ||
sheet | 0.203 |