Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646951.1 | internal | 228 | 1-684(+) |
Amino Acid sequence : | |||
KKREEDLLMAGKHFKYVIIGGGVAAGYAAREFAKQGVKPGELAIISKEAVAPYERPALSKAYLFPESPARLPGFHVCVGSGGERLAPGWYTEKGIELILSTEIVKVDLASKSLVSAAGLT FKYDTLLIATGSTVIRLTDFGVQGADAKNIFYLREIDDADKLIVAINAKKNGKAVIVGGGYIGLELGAVMKLNNFDVTMVYPEPWCMPRLFTSGIAAFYEGYYANKGI | |||
Physicochemical properties | |||
Number of amino acids: | 228 | ||
Molecular weight: | 13,536.490 | ||
Theoretical pI: | 9.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 53.015 | ||
aromaticity | 0.110 | ||
GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.339 | ||
sheet | 0.260 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646951.1 | 3prime_partial | 127 | 383-3(-) |
Amino Acid sequence : | |||
MSKVSYLKVNPAALTRDFEARSTFTISVLRINSMPFSVYHPGASLSPPLPTQTWKPGSLAGDSGKRYALLRAGRSYGATASFEIIASSPGLTPCFANSLAAYPAATPPPMITYLKCFPAI NKSSSLF | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 13,536.490 | ||
Theoretical pI: | 9.882 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
Instability index: | 53.015 | ||
aromaticity | 0.110 | ||
GRAVY | 0.069 | ||
Secondary Structure Fraction | |||
Helix | 0.283 | ||
turn | 0.339 | ||
sheet | 0.260 |