Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646955.1 | 5prime_partial | 199 | 1-600(+) |
Amino Acid sequence : | |||
TNAATFEVRNNCPYTVWAAAVPGRGRRLERGQTWTFNVNPGTKQARVWGRTGCNFDGNGRGRCQTGDCGGVLQCTGYGQPPNTLAEYALNQFNNLDFIDISLVDGFNIPMEFNGCRPIRC TADINGQCPNELRAPGGCNNPCTVFKTDEYCCNSGSCQPTRWSRFFKERCPDAYSYPKDDPTSTFTCPGGTNYRVIFCP* | |||
Physicochemical properties | |||
Number of amino acids: | 199 | ||
Molecular weight: | 10,405.273 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 24.950 | ||
aromaticity | 0.040 | ||
GRAVY | 0.789 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.366 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646955.1 | 5prime_partial | 117 | 3-356(+) |
Amino Acid sequence : | |||
ECSNLRGPKQLSLHGMGRGCPGPWPTARARPNMDLQRESRHEAGQSLGPNWVQLRRKWARPMPDRRLRWCPPVHGLWSATKHLSRIRFKPIQQLGLHRHLVGRWVQYSNGVQWVQTN* | |||
Physicochemical properties | |||
Number of amino acids: | 117 | ||
Molecular weight: | 10,405.273 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 24.950 | ||
aromaticity | 0.040 | ||
GRAVY | 0.789 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.366 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646955.1 | 5prime_partial | 115 | 612-265(-) |
Amino Acid sequence : | |||
RTRLSRAKYNPVVGSTGASESASRIILGITVSIWAPFLKEPGPTCWLTAPRIAAILISLEHSARVVTPTRCPKLVRALPVNVSGAPNWSAPIELHWNIEPIDQRDVYEVQVVELV* | |||
Physicochemical properties | |||
Number of amino acids: | 115 | ||
Molecular weight: | 10,405.273 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 24.950 | ||
aromaticity | 0.040 | ||
GRAVY | 0.789 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.366 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646955.1 | 3prime_partial | 101 | 311-613(+) |
Amino Acid sequence : | |||
MGSIFQWSSMGADQLGAPLTLTGSARTSLGHLVGVTTLALCSRLMSIAAILGAVSQHVGPGSLRKGAQMLTVIPRMILLALSLAPVEPTTGLYFALESLVL | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,405.273 | ||
Theoretical pI: | 9.299 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 24.950 | ||
aromaticity | 0.040 | ||
GRAVY | 0.789 | ||
Secondary Structure Fraction | |||
Helix | 0.347 | ||
turn | 0.267 | ||
sheet | 0.366 |