Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646955.1	5prime_partial	199	1-600(+)
Amino Acid sequence :
TNAATFEVRNNCPYTVWAAAVPGRGRRLERGQTWTFNVNPGTKQARVWGRTGCNFDGNGRGRCQTGDCGGVLQCTGYGQPPNTLAEYALNQFNNLDFIDISLVDGFNIPMEFNGCRPIRC TADINGQCPNELRAPGGCNNPCTVFKTDEYCCNSGSCQPTRWSRFFKERCPDAYSYPKDDPTSTFTCPGGTNYRVIFCP*
Physicochemical properties
Number of amino acids:		199
Molecular weight:		10,405.273
Theoretical pI:		9.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		24.950
aromaticity		0.040
GRAVY		0.789
Secondary Structure Fraction
Helix		0.347
turn		0.267
sheet		0.366

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646955.1	5prime_partial	117	3-356(+)
Amino Acid sequence :
ECSNLRGPKQLSLHGMGRGCPGPWPTARARPNMDLQRESRHEAGQSLGPNWVQLRRKWARPMPDRRLRWCPPVHGLWSATKHLSRIRFKPIQQLGLHRHLVGRWVQYSNGVQWVQTN*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		10,405.273
Theoretical pI:		9.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		24.950
aromaticity		0.040
GRAVY		0.789
Secondary Structure Fraction
Helix		0.347
turn		0.267
sheet		0.366

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646955.1	5prime_partial	115	612-265(-)
Amino Acid sequence :
RTRLSRAKYNPVVGSTGASESASRIILGITVSIWAPFLKEPGPTCWLTAPRIAAILISLEHSARVVTPTRCPKLVRALPVNVSGAPNWSAPIELHWNIEPIDQRDVYEVQVVELV*
Physicochemical properties
Number of amino acids:		115
Molecular weight:		10,405.273
Theoretical pI:		9.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		24.950
aromaticity		0.040
GRAVY		0.789
Secondary Structure Fraction
Helix		0.347
turn		0.267
sheet		0.366

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG646955.1	3prime_partial	101	311-613(+)
Amino Acid sequence :
MGSIFQWSSMGADQLGAPLTLTGSARTSLGHLVGVTTLALCSRLMSIAAILGAVSQHVGPGSLRKGAQMLTVIPRMILLALSLAPVEPTTGLYFALESLVL
Physicochemical properties
Number of amino acids:		101
Molecular weight:		10,405.273
Theoretical pI:		9.299
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		6990 6990
Instability index:		24.950
aromaticity		0.040
GRAVY		0.789
Secondary Structure Fraction
Helix		0.347
turn		0.267
sheet		0.366