Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646963.1 | internal | 106 | 1-318(+) |
Amino Acid sequence : | |||
RPKNMRKVLKNELEVAASADDISAVFRSPDLPRLLVDTLLPGAFEKIEILAGDGGVGTVLNIRFPPGVVPRGYVEKFILMDDRRRLKKVQMIRGGYLYMGATFYMD | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,898.882 | ||
Theoretical pI: | 9.568 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 5960 | ||
Instability index: | 50.900 | ||
aromaticity | 0.085 | ||
GRAVY | -0.057 | ||
Secondary Structure Fraction | |||
Helix | 0.349 | ||
turn | 0.217 | ||
sheet | 0.274 |