Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG646968.1 | internal | 111 | 1-333(+) |
Amino Acid sequence : | |||
KYGLAADNIIDALIVNADGKILNREQMGEDLFWAIRGGGGASFGVILEWKIKLVPVPSTVTVFTVPRTLEQGATAIVHKWQNIAHKLPTELVIRVLISKVNASQAAGTTVQ | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,960.772 | ||
Theoretical pI: | 9.163 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 17990 | ||
Instability index: | 30.151 | ||
aromaticity | 0.063 | ||
GRAVY | 0.256 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.207 | ||
sheet | 0.252 |