Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647000.1 | internal | 256 | 3-770(+) |
Amino Acid sequence : | |||
PSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPDLEIQIHNSWLFFPWHRYYLYFYERILGKLINDPSFAIPYWNWDSPAGMVLPEFYADPK SPLYDHLRDAKHQPPTLVDLDYNLVDPTVSREQQITSNLTIMYRQMVSNAKTSLLFLGSPYRAGDEPDPGAGSVENIPHGPVHLWTGDRTQPNIENMGNFYSAARDPIFYSHHSNIDRLW TIWKGLGGNRRDFTDP | |||
Physicochemical properties | |||
Number of amino acids: | 256 | ||
Molecular weight: | 29,410.715 | ||
Theoretical pI: | 5.672 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 62340 62465 | ||
Instability index: | 49.438 | ||
aromaticity | 0.133 | ||
GRAVY | -0.530 | ||
Secondary Structure Fraction | |||
Helix | 0.313 | ||
turn | 0.262 | ||
sheet | 0.211 |