Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647015.1	internal	247	1-741(+)
Amino Acid sequence :
GGSKYGTSVFREYAMDPSRDIILAYMQNGELLSPDHGFPVRIIIPGFIGGRMVKWLSRIIVTPQESQSHYHFKDNRVLPSHVDAELANSEAWWYKPEYIINELNTNSVITTPSHDEILPI NSATTQRPYTLRGYAYSGGGKKVTRVEVTMDGGDTWQVCELDHPEKPNKYGKYWCWCFWSLEVEVLDLLGAKEIAVRAWDQTLNTQPEKLIWNVMGMMNNCWFRVKMNVCKPHKGEIGLV FEHPTLA
Physicochemical properties
Number of amino acids:		247
Molecular weight:		14,140.280
Theoretical pI:		9.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		38.423
aromaticity		0.064
GRAVY		0.014
Secondary Structure Fraction
Helix		0.360
turn		0.232
sheet		0.248

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647015.1	5prime_partial	125	741-364(-)
Amino Acid sequence :
GKSRVFKNETDLSLVWLAHVHLHPEPAVVHHSHHIPDELLGLSVEGLVPCTNSNLFGTKEVEHLNFQGPEAPAPVLSILVWFLRVIQFTHLPRVASIHRYLHTCHLLSPTRICVAPQRVR PLRGR*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,140.280
Theoretical pI:		9.064
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		12490 12615
Instability index:		38.423
aromaticity		0.064
GRAVY		0.014
Secondary Structure Fraction
Helix		0.360
turn		0.232
sheet		0.248