Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647022.1	internal	238	3-716(+)
Amino Acid sequence :
DFIRLERESVIPILKPKLIMTLANLIEHGSDKAEFLKLCKRVEYIIRSWYLLQFEDLMQLYSLFDPVNGAKKLEQQRLPPDEIDLLEQKFLVHLFEVMRKSNFKIVTQEEIEVARSGQYL LNLPISVDESKLDKKLLGTYFVENPHENLPDHSDKYVIFRRGIGLDRTTDYFFMEKVDMIIARFWASILKWTGLQHILPRKPSPQQQNKPQIANDMSTNAEQEDLFVERIRIENIKLS
Physicochemical properties
Number of amino acids:		238
Molecular weight:		28,121.280
Theoretical pI:		6.034
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26930 26930
Instability index:		38.879
aromaticity		0.097
GRAVY		-0.342
Secondary Structure Fraction
Helix		0.366
turn		0.176
sheet		0.277