Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647037.1 | internal | 260 | 1-780(+) |
Amino Acid sequence : | |||
RFASNVDDEDENCFFNMSRYDESETGNRLALWEDFELRGFLPLVPAQLILDFSRKHTNGSDGGSKEKRARVQRILAAGRALTNIVQIDQKGICFDQKLKKFTIGYEPQISDITSANGMPQ ESPVDKIKIVQVLPPKEQVHAEGEEEDEVIVFKPTVLDKLGDVIAPKLATCEGLGHVEKASKAEWESYVGPISTSLSSSGPQNVFDASNPALASLADKLPQQLQPMNPVSSTWLMEQENS FSNGIKNISIYGNGLTMSSS | |||
Physicochemical properties | |||
Number of amino acids: | 260 | ||
Molecular weight: | 28,606.824 | ||
Theoretical pI: | 4.850 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
Instability index: | 38.905 | ||
aromaticity | 0.069 | ||
GRAVY | -0.422 | ||
Secondary Structure Fraction | |||
Helix | 0.277 | ||
turn | 0.281 | ||
sheet | 0.250 |