Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647039.1 | internal | 245 | 2-736(+) |
Amino Acid sequence : | |||
LEIQVHNSWLFFPWHRYYLYFYERILGKLIDDPSFAIPYWNWDSPAGMVLPEFYADPKSPLYDSLRDAKHQPPTLVDLDYNLVDPNVSREQQLTSNLTIMYRQMVSNAKTSLLFLGSPYR AGDEPDPGAGSIENIPHGPVHLWTGDRTQPNIENMGNFYSAARDPIFYSHHSNIDRLWTIWKGLGGNRRDFTDPDWLNATFLFYDENAQLVRVKVRDCLNQDAMRYKYQDVDIPWLKSKP TPRKA | |||
Physicochemical properties | |||
Number of amino acids: | 245 | ||
Molecular weight: | 28,662.918 | ||
Theoretical pI: | 5.787 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 71850 71850 | ||
Instability index: | 46.964 | ||
aromaticity | 0.143 | ||
GRAVY | -0.593 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.257 | ||
sheet | 0.204 |