Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647044.1 | internal | 291 | 2-874(+) |
Amino Acid sequence : | |||
FSRSSLIRGESLRVFSFKFRVRAMASHIVGYPRMGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSM ARGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKALGVDTVPVLVGPVSYLLLSKHAKGVDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSE KLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTCLKGVNGFGFDL | |||
Physicochemical properties | |||
Number of amino acids: | 291 | ||
Molecular weight: | 32,145.298 | ||
Theoretical pI: | 5.808 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 46870 46870 | ||
Instability index: | 31.126 | ||
aromaticity | 0.124 | ||
GRAVY | -0.021 | ||
Secondary Structure Fraction | |||
Helix | 0.340 | ||
turn | 0.237 | ||
sheet | 0.282 |