Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647065.1 | 3prime_partial | 244 | 39-770(+) |
Amino Acid sequence : | |||
MRAINPRLLLFNHSPIKPTLISFCGINMSARADEAAGFSRPRLVVKKVLAKPQHEGDGAVVRRAIGRMELKYLDPFVMLDEFSVSAPAGFPDHPHRGFETVTYMLQGAFAHQDFAGHKGI IRTGDVQWMTAGRGIIHSEMPAGEGPQWGLQLWINLSSREKMIEPKYQEVPSEEITRAEKDGVEARIIAGEAMGERSPVYTRTPTMYLDFTIKPGAQLHQNIPDSWNSFVYTIEGEGTFG SLNS | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 27,154.705 | ||
Theoretical pI: | 6.454 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 30940 | ||
Instability index: | 42.915 | ||
aromaticity | 0.090 | ||
GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.254 | ||
sheet | 0.262 |