Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647071.1 | internal | 273 | 1-819(+) |
Amino Acid sequence : | |||
DDSTTPVKAQTIDELHSLQKKKSAPTTPIKDADGTFAIISEEERQMLQLQSISASLASLTRETGPKLVRGDQARKVEAAKVSNVVDYTPAISVSDSSLKSTQVLHNLSPAELYEQAIKYE KGSFITSTGALATLSGAKTGRSPRDKRVVRDETTEDELWWGKGSPNIEMDEHTFLVNRERAVDYLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFGTPD FTIYNAGQFPCNRYTHYMTSSTSIDLNLARREM | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 30,732.096 | ||
Theoretical pI: | 5.709 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28545 | ||
Instability index: | 39.223 | ||
aromaticity | 0.073 | ||
GRAVY | -0.568 | ||
Secondary Structure Fraction | |||
Helix | 0.264 | ||
turn | 0.223 | ||
sheet | 0.249 |