Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647094.1 | internal | 261 | 2-784(+) |
Amino Acid sequence : | |||
FNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVG NEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRN LFDALVDSVYASLEKAGGGGL | |||
Physicochemical properties | |||
Number of amino acids: | 261 | ||
Molecular weight: | 28,739.545 | ||
Theoretical pI: | 9.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.840 | ||
aromaticity | 0.100 | ||
GRAVY | -0.029 | ||
Secondary Structure Fraction | |||
Helix | 0.356 | ||
turn | 0.299 | ||
sheet | 0.215 |