Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647103.1 | 3prime_partial | 231 | 60-752(+) |
Amino Acid sequence : | |||
MGKCYPTVSDEYQQAVEKCRKKLRGLIAEKNCAPLMLRLAWHSAGTYDVKTKTGGPFGTMKHASELAHGANNGLDIAVRLLEPIKEQFPILSYGDFYQLAGVVAVEVTGGPEIPFHPGRE DKSVPPPEGRLPDATKGTDHLRQVFVHQMGLSDQDIVALSGGHTLGRCHKERSGFEGPWTFNPLIFDNSYFKELLSGEKEGLLQLPTDKVLLEDPVFCPLVKKYAADEDAF | |||
Physicochemical properties | |||
Number of amino acids: | 231 | ||
Molecular weight: | 25,466.790 | ||
Theoretical pI: | 5.911 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 33.532 | ||
aromaticity | 0.087 | ||
GRAVY | -0.347 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.238 | ||
sheet | 0.268 |