Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647105.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
PFYFFFFSIFFDSATMESVNAWGNAPLNQVDEEIFDLIEKEKRRQCRGIELIASENFTSFAVIEALGSALTNKYSEGMPGNRYYGGNEFIDEIENLCRSRALQVFHLDPSKWGVNVQPYS GSPANFAAYTALLNPHDRIMGLDLPSGGHLTHGYYTSGGKKISATSIYFESLPYKVNSTTGYIDYDKLEEKALDFRPKLIICGGSAYPRDWDYARFRSVADKCGALLLCDMAHISGLVAA QEAANPFEYCDVVTTTTHKSLRGPRAGMIFYR | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 16,876.413 | ||
Theoretical pI: | 11.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 56.594 | ||
aromaticity | 0.039 | ||
GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.276 | ||
sheet | 0.178 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647105.1 | 5prime_partial | 152 | 818-360(-) |
Amino Acid sequence : | |||
PVKDHTSSWAPQALVGCGCHHITILKWVGSFLSSNKTANMSHITEQQRPALIRNGPKPGVIPIPGVRTSTTYNQFGSEIQRLLLQLIIIDISSRRVHLIRQALEVNRGSRYLLPTRSVIP MSQVAARRKIQTHNPIMGVEKSRVGSEIRGTT* | |||
Physicochemical properties | |||
Number of amino acids: | 152 | ||
Molecular weight: | 16,876.413 | ||
Theoretical pI: | 11.312 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 56.594 | ||
aromaticity | 0.039 | ||
GRAVY | -0.226 | ||
Secondary Structure Fraction | |||
Helix | 0.296 | ||
turn | 0.276 | ||
sheet | 0.178 |