Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647110.1 | internal | 267 | 1-801(+) |
Amino Acid sequence : | |||
ILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLKAFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTSLKGVTGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWANDL AASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNETKLDDEIKSWLAFAAQKVVEVNALARALSGQKDKEYFAANAAAQASRRSSPRVTNEAVQKAAAALKGSDHRRATNVSERLDAQ QKKLNLPILPTTTIGSFPQTIELRRVR | |||
Physicochemical properties | |||
Number of amino acids: | 267 | ||
Molecular weight: | 28,799.530 | ||
Theoretical pI: | 6.964 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25440 | ||
Instability index: | 31.902 | ||
aromaticity | 0.071 | ||
GRAVY | -0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.322 | ||
turn | 0.199 | ||
sheet | 0.318 |