Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647118.1 | internal | 276 | 1-828(+) |
Amino Acid sequence : | |||
QMSLSLLASVSASSLTQKKPLQGAKTPAIPNRCGSKQARFISCEKKQGGEHGHENHVIDRRNVLLGIGGLYGATATIGSQGKVAIGAPVQPPDLSKCHLALDSDAGQEVNCCPPYSTANI IDFVPPSHDERLRRRKPAHMLNPEEIEKFKTAIAKMKALDKDDPWNFMQQATIHCTYCNGAFDQVGFPETLLQVHGSWLFLPWHRYYLYFWERILGKLIGDDTFAIPYWNWDNPEGMRMP EFYLDKMSPLYNDNRNHNHYNALMDYDYSIGDPNPT | |||
Physicochemical properties | |||
Number of amino acids: | 276 | ||
Molecular weight: | 31,167.018 | ||
Theoretical pI: | 6.625 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 50880 51255 | ||
Instability index: | 51.969 | ||
aromaticity | 0.101 | ||
GRAVY | -0.524 | ||
Secondary Structure Fraction | |||
Helix | 0.275 | ||
turn | 0.264 | ||
sheet | 0.232 |