Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647125.1	internal	288	1-864(+)
Amino Acid sequence :
ADRLAVGAPIMPPDLSKCGPADLPAGAKPTDCCPPENFKNIVDFKLPSPSSPMRVRPAAQLVDDAYIEKYKKAVALMKALPADDPRNFTQQANVHCAYCDGAYDQIGFPNLEIQVHNSWL FFPWHRYYLYFYERILGKLIDDPSFAIPYWNWDSPAGMVLPEFYADPKSPLYDSLRDAKHQPPTLVDLDYNLVDPNVSREQQLTSNLTIMYRQMVSNAKTSLLFLGSPYRAGDEPDPGAG SIENIPHGPVHLWTGDRTQPNIENMGNFYSAARDPIFYSHHSNIDRLW
Physicochemical properties
Number of amino acids:		288
Molecular weight:		32,519.383
Theoretical pI:		5.309
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		56840 57090
Instability index:		51.779
aromaticity		0.118
GRAVY		-0.441
Secondary Structure Fraction
Helix		0.299
turn		0.278
sheet		0.229