Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647127.1	internal	263	2-790(+)
Amino Acid sequence :
NAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKALGVDTVPVLVGPVSYLLLSKHAKGVDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDSEKLK AFTAAYSELESTLSGVNVVIETYFADVPAEAYKTLTCLKGVNGFGFDLVRGLKTLDLIKGGFPSGKYLFAGVVDGRNIWANDLAASLSTLEALEGIVGKDKLVVSTSCSLLHTAVDLVNE TKLDDEIKSWLAFAAQKIVEVNA
Physicochemical properties
Number of amino acids:		263
Molecular weight:		14,875.753
Theoretical pI:		10.225
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		52.712
aromaticity		0.073
GRAVY		-0.308
Secondary Structure Fraction
Helix		0.241
turn		0.299
sheet		0.226

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647127.1	5prime_partial	137	789-376(-)
Amino Acid sequence :
AFTSTIFCAAKASHDLISSSSLVSFTRSTAVWRSEQEVDTTSLSLPTMPSRASRVLREAARSLAQMLRPSTTPAKRYFPDGNPPLIKSRVFSPRTKSKPNPLTPFKQVSVLYASAGTSAK YVSMTTLTPDKVDSSSE*
Physicochemical properties
Number of amino acids:		137
Molecular weight:		14,875.753
Theoretical pI:		10.225
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		9970 9970
Instability index:		52.712
aromaticity		0.073
GRAVY		-0.308
Secondary Structure Fraction
Helix		0.241
turn		0.299
sheet		0.226