Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647128.1 | internal | 250 | 1-750(+) |
Amino Acid sequence : | |||
PRRTMNASECVARGCALQCAILSPTFKVREFQVHENFPFPIALSWKGSAPDSQNGEANHQQNTVIFPKGNPMPSVKAMTFYRASTFTVDLVYNDVNEVKASPRISTYTIGPFQSSKGERA KVKVKVRLNLHGVVSVESATLLEEEEVEIPVVKEPTKEASKMDTEENPTEASSNQAGESDVSMQDAKGSTDDVGAENGVSESAEKPTEMETDSKVEAPKKKVKKTNIPVAEVVYGGMVPV DLQKAVEKEF | |||
Physicochemical properties | |||
Number of amino acids: | 250 | ||
Molecular weight: | 27,267.370 | ||
Theoretical pI: | 5.233 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 40.850 | ||
aromaticity | 0.056 | ||
GRAVY | -0.536 | ||
Secondary Structure Fraction | |||
Helix | 0.236 | ||
turn | 0.260 | ||
sheet | 0.256 |