Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647131.1 | internal | 284 | 2-853(+) |
Amino Acid sequence : | |||
VGVSDVFSVPGDFNLTLLDHLIAEPGLNVVGCCNELNAGYAADGYARSRGAGACVVTFTVGGLSVINAIAGAYSENLPVICIVGGPNSNDYGTNRILHHTIGLPDFSQELRCFQTVTCFQ AVINNLEDAHELIDTAISTSLKESKPVYISISCNLSAIPHPTFSRQPVPFCLNPKMSNQMGLQAAVEATAEFLNKAVKPVLVGGPKLRVAKARNAFVELADACGFPVAVMPSAKGLVPEH HPHFIGTYWGAVSTTFCAEIVESADAYLFAGPIFYDYSSVGYSL | |||
Physicochemical properties | |||
Number of amino acids: | 284 | ||
Molecular weight: | 13,953.700 | ||
Theoretical pI: | 9.467 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 22.803 | ||
aromaticity | 0.023 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.338 | ||
sheet | 0.185 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647131.1 | 3prime_partial | 130 | 391-2(-) |
Amino Acid sequence : | |||
MCIFQVVNYSLETSDSLKTSKLLAKIRQSNGMVKNSVSPIIVGIRPSNDTNNWKILAISSGNRINNTKATNSKCNNTSASTARPSIAISGVPSIKLVAATNDVEPGLSDQMVKKREVEIP GNREHIGDAD | |||
Physicochemical properties | |||
Number of amino acids: | 130 | ||
Molecular weight: | 13,953.700 | ||
Theoretical pI: | 9.467 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 22.803 | ||
aromaticity | 0.023 | ||
GRAVY | -0.340 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.338 | ||
sheet | 0.185 |