Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647141.1 | 3prime_partial | 251 | 33-785(+) |
Amino Acid sequence : | |||
MEKALNRQQVLLQHLRPSASLSQLGDESAISASICLAGDSSAYQRTSVFGDDVVIVAAYRTPICKSRRGGFKDTFADDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMA AFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTLNQVAWDSTVNPKAQTLQKAQDCLLPMGITSENVAQRYGVTRQEQDQAAVDSHRKAAAATASGKFKDEII PVATKLVDPKT | |||
Physicochemical properties | |||
Number of amino acids: | 251 | ||
Molecular weight: | 26,629.943 | ||
Theoretical pI: | 6.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 39.910 | ||
aromaticity | 0.052 | ||
GRAVY | -0.076 | ||
Secondary Structure Fraction | |||
Helix | 0.267 | ||
turn | 0.215 | ||
sheet | 0.271 |