Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647159.1 | 3prime_partial | 241 | 50-772(+) |
Amino Acid sequence : | |||
MANIDIEGLLKELPNDGRVPKTKIVCTLGPASRSVPMLEKLLKAGMNVARFNFSHGTHEYHQETLNSLKIAMQNTQILCAVMLDTKGPEIRTGFLKDGKPIQLKEGEEITITTDYSIKGD EKMISMSYKKLAVDLKPGNTILCADGTITLSVISCDPAAGTVKCRCENTAVLGERKNVNLPGIVVDLPTLTEKDKEDILGWGVPNKIDMIALSFVRKGSDLVNVRQVLGPHAKQIKLMSK V | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 26,326.579 | ||
Theoretical pI: | 8.654 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10345 | ||
Instability index: | 26.640 | ||
aromaticity | 0.033 | ||
GRAVY | -0.124 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.228 | ||
sheet | 0.257 |