Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647166.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
FMATFFNKTTSSPMAATVLLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIK YIAVGNEVSPIREAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANN LVYRNLFDALVDSVYASLEKAGGGG | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 29,224.113 | ||
Theoretical pI: | 9.161 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 48.200 | ||
aromaticity | 0.106 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.355 | ||
turn | 0.294 | ||
sheet | 0.215 |