Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647172.1	internal	101	2-304(+)
Amino Acid sequence :
YGRGPIQISWNFNYGQAGRAIGVDLINNPELVARDPVISFKTALWFWMTPQSPKPSCHDVILGRWRPSAADQAAGRVPGYGVITNIINGGIECGKGQNPQV
Physicochemical properties
Number of amino acids:		101
Molecular weight:		10,977.368
Theoretical pI:		9.187
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		26470 26595
Instability index:		50.535
aromaticity		0.099
GRAVY		-0.221
Secondary Structure Fraction
Helix		0.307
turn		0.337
sheet		0.149