Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647172.1 | internal | 101 | 2-304(+) |
Amino Acid sequence : | |||
YGRGPIQISWNFNYGQAGRAIGVDLINNPELVARDPVISFKTALWFWMTPQSPKPSCHDVILGRWRPSAADQAAGRVPGYGVITNIINGGIECGKGQNPQV | |||
Physicochemical properties | |||
Number of amino acids: | 101 | ||
Molecular weight: | 10,977.368 | ||
Theoretical pI: | 9.187 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 50.535 | ||
aromaticity | 0.099 | ||
GRAVY | -0.221 | ||
Secondary Structure Fraction | |||
Helix | 0.307 | ||
turn | 0.337 | ||
sheet | 0.149 |