Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647192.1 | internal | 244 | 1-732(+) |
Amino Acid sequence : | |||
EKHLSMAISSAVAYQSPIMCRANNNHVFDAKQIRRAAEVADKSAGFTSPHPNFGCVITRNDNVVGEGFLYAQGSKCAELQAVEAAGELSRGGTAYLNMEPGDCHGDETAISALVKAGISR VVVGIRHPLGHLRGKAIHSLRSEGLQVDVLGENLQSKVIQDALKSCHLVNAPLLFRAASKVPFSRLKYAMTADGKIAASSGHASWVSSKQSRHRVFELRGRSDAIIVGGNTVRRDDPQLT ARHG | |||
Physicochemical properties | |||
Number of amino acids: | 244 | ||
Molecular weight: | 26,131.378 | ||
Theoretical pI: | 9.422 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11710 | ||
Instability index: | 45.874 | ||
aromaticity | 0.049 | ||
GRAVY | -0.220 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.258 | ||
sheet | 0.262 |