Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647194.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
SNCLCCNLLSEPCKRFKSSSTLDEQIEDMMDSTVHEVSNQNPRITWEGCSVLLDINDGDRLVFARLSTGSTVKIGNKKCSLRPLIGCPFGSLFQVETGPKGLYLSRVIAPSDADHPLEKD DFQLKDESKDNRHLVDNNTAQNLSCEDIDELRR* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,766.237 | ||
Theoretical pI: | 10.469 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 58.484 | ||
aromaticity | 0.123 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.239 | ||
sheet | 0.210 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647194.1 | 5prime_partial | 138 | 837-421(-) |
Amino Acid sequence : | |||
TISIEYGVLPKYVLHMRPVPPKRSATAPVTRPPTKSTTRTSEDVLTLAMDKRRDKTSTRKNPILAGYFLKYASHILRAKGRLKRTLGAYFFCFLSLYFSCENNVFFSKVVLFAIRASTIW SPVAPYLRNSSISSHERF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,766.237 | ||
Theoretical pI: | 10.469 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
Instability index: | 58.484 | ||
aromaticity | 0.123 | ||
GRAVY | -0.166 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.239 | ||
sheet | 0.210 |