Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647198.1	3prime_partial	238	122-835(+)
Amino Acid sequence :
MPEIEEQEHDVGANAALPVKNILFGKYELGKLLGCGAFAKVYHARNLQSGQSVAIKAISKQKVLKSGLTSHIKREICIMRRLRHPNIVKLIEVLASKTKIFFVMEFVKGGELFSKVAKGR FSEDLSRRYFQQLISAVEYCHSHGVFHRDLKPENLLLDENGDLKVSDFGLSAITDEQIRNDGLLHTLCGTPAYVAPEILAKQGYDGAKVDIWSCGVILFVMNAGYLPFNDPNLMVMYR
Physicochemical properties
Number of amino acids:		238
Molecular weight:		11,049.204
Theoretical pI:		10.371
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		59.469
aromaticity		0.056
GRAVY		-0.680
Secondary Structure Fraction
Helix		0.131
turn		0.505
sheet		0.196

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647198.1	3prime_partial	124	373-2(-)
Amino Acid sequence :
MAQATHDADFAFDVRSESGFEDFLLADGFNGDALAGLEVPGVVDLGKGAAAEEFPKLVFPEKDILDGKGCIGAHIMFLFLDLWHWDQRSTTLRFGQGDFVEKKRDSLFLRFFSFLFPPKA LRSS
Physicochemical properties
Number of amino acids:		124
Molecular weight:		11,049.204
Theoretical pI:		10.371
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		59.469
aromaticity		0.056
GRAVY		-0.680
Secondary Structure Fraction
Helix		0.131
turn		0.505
sheet		0.196

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647198.1	complete	107	147-470(+)
Amino Acid sequence :
MMWAPMQPFPSRISFSGNTSLGNSSAAAPLPRSTTPGTSNPAKASPLKPSASKKSSNPDSLLTSNAKSASCVACAIQTSSNSSKSWPPKPRSSSSWSSSKAENYSPK*
Physicochemical properties
Number of amino acids:		107
Molecular weight:		11,049.204
Theoretical pI:		10.371
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		17990 18115
Instability index:		59.469
aromaticity		0.056
GRAVY		-0.680
Secondary Structure Fraction
Helix		0.131
turn		0.505
sheet		0.196