Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647231.1	internal	275	2-826(+)
Amino Acid sequence :
TDQCIGSHSSETLVDCNVLIARALVKAGVDCMFGVVGIPVTSLANRALAAGIRFIAFHNEQSAGYAASAYGYLTGRPGVLLTVSGPGCVHGLAGLSNAGANAWPMIMISGSCDQRDFGKG DFQELDQIEAVKPFVKFAAKAKDISEIPNHVFEVLSRSISGRPGGCYLDVPSDVLHQSVPEAEAVRLLKEAAAKSESETNANGIGGFGEIAKAVALLREAERPLIVFGKGAALARSENEL KKLVETTGIPFLPTPMGKGLLPDTHELAATAARSL
Physicochemical properties
Number of amino acids:		275
Molecular weight:		13,225.621
Theoretical pI:		6.765
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		80.472
aromaticity		0.051
GRAVY		-0.774
Secondary Structure Fraction
Helix		0.231
turn		0.291
sheet		0.256

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647231.1	5prime_partial	256	826-56(-)
Amino Acid sequence :
QRSRSCCCKLVSIRQQTLPHWCWQERNSSRLHQFLQLIFRSRQGRTFPKHNQRPLSLSQQRYGFCNLSKPTNSICICFALAFCCCLLQKPNSLSFRNRLVKNIRRNIQITPARTTRDRST QNLKHVIRDFRNILRFRSELHEGFYCFNLIELLKITLPEVPLIARAGDHNHRPSVRTGVRESSEAVHAAGAGDGEENAGAAGQVSIRGRGVAGGLLVVKRDESDSSSQGSVRQRGNRNSD DAEHAIDTSFDESSSN*
Physicochemical properties
Number of amino acids:		256
Molecular weight:		13,225.621
Theoretical pI:		6.765
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		80.472
aromaticity		0.051
GRAVY		-0.774
Secondary Structure Fraction
Helix		0.231
turn		0.291
sheet		0.256

Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647231.1	5prime_partial	117	827-474(-)
Amino Acid sequence :
PAISQLLLQAREYQATNPSPLVLARTEFQSSPPISSTHFPISPRPHLSQTQSTASQPLSTTLRLLQSLQTHQFHLHLFRSRFLLLPPSKAEQPQLPEPTGEEHPTEHPDNTRQDDPR*
Physicochemical properties
Number of amino acids:		117
Molecular weight:		13,225.621
Theoretical pI:		6.765
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		80.472
aromaticity		0.051
GRAVY		-0.774
Secondary Structure Fraction
Helix		0.231
turn		0.291
sheet		0.256