Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647232.1 | 3prime_partial | 232 | 69-764(+) |
Amino Acid sequence : | |||
MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTT GGFEAGISKDGQTREHALLAFTLGVKQMICCCNKMDATTPKYSKARYDEIVKEVSSYLKKVGYNPDKIPFVPISGFEGDNMIERSTNLDWYKGPTLLEALDQINEPKRPSDK | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,121.754 | ||
Theoretical pI: | 8.455 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30160 | ||
Instability index: | 30.844 | ||
aromaticity | 0.086 | ||
GRAVY | -0.408 | ||
Secondary Structure Fraction | |||
Helix | 0.293 | ||
turn | 0.198 | ||
sheet | 0.216 |