Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647238.1 | internal | 272 | 3-818(+) |
Amino Acid sequence : | |||
LSLSLMALYLLYESASGYALFEAHGLDEIGQNTEAVRNSVLDLNRFGRVVKLVSFQPFSSALDALNQCNAVSEGLMTDELRNFLELNLPKVKEGKKAKFSVGVAEPKIGSHINEVTKIPC QSNEFIVELLRGVRLHFDRFIKDLKLSDLEKAQLGLAHSYSRAKVKFNVNRVDNMVIQAIFLLDTLDKDINSFSMRVREWYSWHFPELVKIVNDNYLYAKVAKYVKDKSELSEEKIPGLI EILGDEDKAKEVLEAARASMGQDLSEVDLINV | |||
Physicochemical properties | |||
Number of amino acids: | 272 | ||
Molecular weight: | 30,715.929 | ||
Theoretical pI: | 5.530 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22920 23045 | ||
Instability index: | 21.050 | ||
aromaticity | 0.085 | ||
GRAVY | -0.119 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.210 | ||
sheet | 0.313 |