Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647243.1 | internal | 278 | 2-835(+) |
Amino Acid sequence : | |||
KDYLDFAAEIIRHTDGGPPRWFCPLECGQPINNAPLLLFLPGMDGVGLGLILHHNALGRIFEVRCLHIPVFDRTPFEGLVKYVENTVRLEYALSPHKPIYLVGDSFGGCLALAVAARNPA IDLVLVLANPATSFDKSQFQPLLPILESLPEELHFSLPYLLSFIMGDPVRMSMATIDNRLPPLQSLEQLSSHLVALLPRLSVVADIIPKQTLLWKLKLLKSAASYANSRLHAVTADVLVL ASGKDNMLPSGDEAQRLSTSLQNCKTRYFKEHGHTLLM | |||
Physicochemical properties | |||
Number of amino acids: | 278 | ||
Molecular weight: | 30,719.552 | ||
Theoretical pI: | 6.581 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21680 | ||
Instability index: | 45.035 | ||
aromaticity | 0.076 | ||
GRAVY | 0.184 | ||
Secondary Structure Fraction | |||
Helix | 0.360 | ||
turn | 0.241 | ||
sheet | 0.320 |