Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647263.1 | internal | 271 | 1-813(+) |
Amino Acid sequence : | |||
QEAICNREEGIARIIVRHYQPLAWAKWCRRLPRLIGTIRRMRDFYMEITFHFESSVIPFISRIAPSDTYKIWKRGSNLRADMTLAGFDGFRIQRSDQSILFLGDGSEDGKVPPGSLCMIS HKDKEVMNALDGAGAPATEAEVQQEVAAMSQTNIFRPGIDVTQAVLLPQLTWRRQEKTEMVGPWKAKVYDMHNVVVSVKSRRVPGAMTDEEFFSTCNENDTESDYDDILTEDEKKQLEVA LKMESSELSAEDGVSEGFIAHRHSCYEQREV | |||
Physicochemical properties | |||
Number of amino acids: | 271 | ||
Molecular weight: | 30,869.617 | ||
Theoretical pI: | 5.302 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
Instability index: | 63.523 | ||
aromaticity | 0.081 | ||
GRAVY | -0.469 | ||
Secondary Structure Fraction | |||
Helix | 0.273 | ||
turn | 0.199 | ||
sheet | 0.262 |