Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647276.1 | internal | 239 | 2-718(+) |
Amino Acid sequence : | |||
FARSSLIRGESLRVFSFKFRVRAMASHIVGYPRTGPKRELKFALESFWDGKSSAEDLEKVSADLRSSIWKQMADAGIKYIPSNTFSHYDQVLDTTAMLGAVPSRYNWTGGEIGFDTYFSM ARGNAAVPAMEMTKWFDTNYHFIVPELGPDTKFSYASHKAVNEYNEAKAFGVDTVPVLVGPVSYLLLSKHAKGTDKSFSLLSLLGSILPVYKEVVAELKAAGASWIQFDEPTLVLDLDS | |||
Physicochemical properties | |||
Number of amino acids: | 239 | ||
Molecular weight: | 26,530.902 | ||
Theoretical pI: | 6.590 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42400 | ||
Instability index: | 30.051 | ||
aromaticity | 0.126 | ||
GRAVY | -0.104 | ||
Secondary Structure Fraction | |||
Helix | 0.331 | ||
turn | 0.243 | ||
sheet | 0.268 |