Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647281.1 | 5prime_partial | 182 | 558-10(-) |
Amino Acid sequence : | |||
SLSDLAINQQKMLFKSKLDCVKEPIPEIVFKKLWKMFLEVDVPVMTLIPYGGRMSEIPDSEIPFPHRAGNIFHIGYFVFLNQNEGTAASKKNMDWIRRLYNYMTPYVSKSPRGAYLNYRD LDLGYTKNGTATYAEAKVWGSKYFKNNFDRLVQVKSKVDPDNFFRNEQSIPPVLSLADGKKN* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 21,016.986 | ||
Theoretical pI: | 9.367 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 31400 31400 | ||
Instability index: | 32.318 | ||
aromaticity | 0.132 | ||
GRAVY | -0.448 | ||
Secondary Structure Fraction | |||
Helix | 0.335 | ||
turn | 0.258 | ||
sheet | 0.209 |