Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647284.1	internal	239	2-718(+)
Amino Acid sequence :
GRETNRESTMAFVKAQKSKAYFKRYQVKFKRRRAGKTDYRARIRLINQDKNKYNTPKYRFVVRFSNKDIVAQIISASIAGDLVLAAAYSHELPHYGLEVGLTNYAAAYCTGLLLARRVLK MLEMDDEYQGNVEATGEDFSVEPTDTRRPFRALLDVGLVRTTTGNRVFGALKGALDGGLDIPHSDKRFAGFKKDDKQLDAEVHRKYIFGGHITSYMQTLMEDEPEKYQSHFSEYIKKGI
Physicochemical properties
Number of amino acids:		239
Molecular weight:		27,310.783
Theoretical pI:		9.550
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		20860 20860
Instability index:		32.323
aromaticity		0.109
GRAVY		-0.593
Secondary Structure Fraction
Helix		0.293
turn		0.180
sheet		0.247