Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647287.1 | internal | 134 | 3-404(+) |
Amino Acid sequence : | |||
QELEWLKAQKIVVSVDLVDVAKTQLKFLAAVDRNRCLYDGPVLHRAIFRYKTYWLPLLAKCVESKFSERPLVVPLDCEWIWHCHRLNPVRYKADCEEFYGRILDNKNVLSTVHGACKNET EKIWNRLYPEEPYE | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 15,924.258 | ||
Theoretical pI: | 7.759 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38305 | ||
Instability index: | 35.571 | ||
aromaticity | 0.119 | ||
GRAVY | -0.356 | ||
Secondary Structure Fraction | |||
Helix | 0.373 | ||
turn | 0.149 | ||
sheet | 0.269 |