Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647295.1 | internal | 246 | 1-738(+) |
Amino Acid sequence : | |||
PITGLADFNKLSAKLILGADSPAIQENRVATVQCLSATGSLRVGAEFLARHYHQHTIYIPQPTWGNHPKVFTLAGLSVKYYRYYDPATRGLDFQGLMEDLGSAPSGAIVLLHACAHNPTG VDPTLEQWDHIRQLMRSKSLLPFFDSAYQGFASGSLDADAQSVRMFVADGGECLAAQSYAKNMGLYGERVGALSIICKSADVASRVESQLKLVIRPMYSNPPIHGASIVATILKDREMYE EWTLEL | |||
Physicochemical properties | |||
Number of amino acids: | 246 | ||
Molecular weight: | 26,917.411 | ||
Theoretical pI: | 6.257 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 32890 33140 | ||
Instability index: | 36.683 | ||
aromaticity | 0.089 | ||
GRAVY | -0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.309 | ||
turn | 0.236 | ||
sheet | 0.289 |