Acc_NO	ORF type	length	start-end position (strand +/-)
>JG647312.1	internal	240	1-720(+)
Amino Acid sequence :
YLSIYLSIYLSIGCWLMAKEGFGLEITELRLGLPGGGTDHNQYSSSCGTVVLEKKAEKKRVFSDMISDENSSNVGHKKVNNHQSSCNKMNTNTSTNNNNNSGQQIVGWPPVRSYRKKNNS TNYYASAAKDQENTSESEKLYVKVSMDGIPYLRKIDLNTHEAYSDLALAFQKLFGCYGIVDGGMLRDSENSEYIPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRTEKGKSFAVEQRN
Physicochemical properties
Number of amino acids:		240
Molecular weight:		27,167.250
Theoretical pI:		7.061
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		41370 41620
Instability index:		43.443
aromaticity		0.096
GRAVY		-0.658
Secondary Structure Fraction
Helix		0.279
turn		0.292
sheet		0.217