Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647313.1 | internal | 242 | 3-728(+) |
Amino Acid sequence : | |||
SLSLSLSLSLSLSLSSPFMDSSSGNLVFKDSSWWLFTLPAFFGTKTLSPHDHHTFLLLLSLFLAFIALSLLTWALSSGGSAWKHGRNHKGLVPITGPRGLPVFGTLFALSHGLPHRTLAA MARTMTQTTQQLMAFSLGSSPAVVTSDPHIAREILTSADFADRPLKQSAQDLMFNRAIGFAPNGTYWRFLRRIASSHLFAPKRIMAHEARRQIDCDAMVSAVAEEQASCGNVGLRKHLQV AA | |||
Physicochemical properties | |||
Number of amino acids: | 242 | ||
Molecular weight: | 26,359.127 | ||
Theoretical pI: | 10.199 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29115 | ||
Instability index: | 46.783 | ||
aromaticity | 0.091 | ||
GRAVY | 0.163 | ||
Secondary Structure Fraction | |||
Helix | 0.310 | ||
turn | 0.260 | ||
sheet | 0.306 |