Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647321.1 | 3prime_partial | 238 | 79-792(+) |
Amino Acid sequence : | |||
MAARRISTLLSRSLNPSLRSLGKNSSWSRGGISRFGTAAVVEEPITPSVQVNHNQLLINGQFVDAASGRTFPTLDPRTGEIIAHVAEADSEDVNRAVSAARKAFDEGPWPKMSAYERSRV ISRFADLLEKHTEEIAALETWDNGKPYEQALRAEIPMVVRLFRYYAGWADKIHGLTVPADGAHHVQVLHEPIGVAGQIIPWNFPLLMFAWKVGPALATGNTIVLKTAEQTPLSALYAA | |||
Physicochemical properties | |||
Number of amino acids: | 238 | ||
Molecular weight: | 26,047.336 | ||
Theoretical pI: | 7.078 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 40450 40450 | ||
Instability index: | 35.553 | ||
aromaticity | 0.080 | ||
GRAVY | -0.129 | ||
Secondary Structure Fraction | |||
Helix | 0.298 | ||
turn | 0.239 | ||
sheet | 0.298 |