Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647325.1 | internal | 273 | 1-819(+) |
Amino Acid sequence : | |||
RYEHGSFITSSGAFATLSGAKTGRSPRDKRVVKDATTEEELWWGKGSPNIEMDEHTFMVNRERAVDYLNSLDKVFVNDQFLNWDPEHRIKVRIVSARAYHSLFMHNMCIRPTPEELEDFG TPDFTIYNAGQFPCNRYTHYMTSSTSIDLNLARREMVILGTQYAGEMKKGLFSVMHYLMPKRQILSLHSGCNMGRDGDVALFFGLSGTGKTTLSTDHNRYLIGDDEHCWSENGVSNIEGG CYAKCIDLSREKEPDIWNAIKFGTVLENIVFDE | |||
Physicochemical properties | |||
Number of amino acids: | 273 | ||
Molecular weight: | 31,105.691 | ||
Theoretical pI: | 5.711 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 42400 42775 | ||
Instability index: | 44.240 | ||
aromaticity | 0.106 | ||
GRAVY | -0.473 | ||
Secondary Structure Fraction | |||
Helix | 0.286 | ||
turn | 0.242 | ||
sheet | 0.231 |