Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647333.1 | internal | 265 | 1-795(+) |
Amino Acid sequence : | |||
LQLTGAQIRVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPIREAQYVPFVLPAMRNI YNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALVDSVYASLEKAGGGGLE IVVSESGWPSAGGTATSIDNARTYN | |||
Physicochemical properties | |||
Number of amino acids: | 265 | ||
Molecular weight: | 29,224.762 | ||
Theoretical pI: | 8.624 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33350 33350 | ||
Instability index: | 47.007 | ||
aromaticity | 0.098 | ||
GRAVY | -0.164 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.309 | ||
sheet | 0.196 |