Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>JG647345.1 | internal | 259 | 3-779(+) |
Amino Acid sequence : | |||
SPMAATVPLLGLFLATLQLTGAQIGVCYGRDGSNLPPPQEVVALYRQRNIGRMRIYDPSPQVLQALRGSNIELILGVPNPDLQRVANDPGFANNWVQQNVRNYGDVRIKYIAVGNEVSPI REAQYVPFVLPAMRNIYNAIAAAGLQDRIKVSTAIDTGVITDSYPPSRGVFRPDVRNYITPIINFLVSNRSPILVNVYPYFSFIGTPNMKLQYALFTNPNPEFTDPANNLVYRNLFDALV DSVYASLEKAGGGGLEIVV | |||
Physicochemical properties | |||
Number of amino acids: | 259 | ||
Molecular weight: | 28,485.302 | ||
Theoretical pI: | 8.620 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26360 26360 | ||
Instability index: | 47.634 | ||
aromaticity | 0.097 | ||
GRAVY | 0.013 | ||
Secondary Structure Fraction | |||
Helix | 0.363 | ||
turn | 0.297 | ||
sheet | 0.216 |